Mastery Studying Ensures Right Private Protecting Tools Use in Simulated Medical Encounters of COVID-19
Introduction: The right use of private protecting gear (PPE) limits transmission of great communicable illnesses to healthcare employees, which is critically vital within the period of coronavirus illness 2019 (COVID-19). Nevertheless, prior research illustrated that healthcare employees continuously err throughout software and elimination of PPE. The purpose of this research was to find out whether or not a simulation-based, mastery studying intervention with deliberate follow improves right use of PPE by physicians throughout a simulated scientific encounter with a COVID-19 affected person.
Strategies:
This was a pretest-posttest research carried out within the emergency division at a big, educational tertiary care hospital between March 31-April 8, 2020. A complete of 117 topics participated, together with 56 college members and 61 resident physicians. Previous to the intervention, all members acquired institution-mandated training on PPE use by way of a web-based video and supplemental supplies.
Contributors accomplished a pretest expertise evaluation utilizing a 21-item guidelines of steps to accurately don and doff PPE. Contributors have been anticipated to fulfill a minimal passing rating (MPS) of 100%, decided by an skilled panel utilizing the Mastery Angoff and Affected person Security standard-setting strategies. Contributors that met the MPS on pretest have been exempt from the tutorial intervention.
Testing occurred earlier than and after an in-person demonstration of correct donning and doffing strategies and 20 minutes of deliberate follow. The first end result was a change in evaluation scores of right PPE use following our instructional intervention. Secondary outcomes included variations in efficiency scores between college members and resident physicians, and variations in efficiency throughout donning vs doffing sequences.
Outcomes: All members had a imply pretest rating of 73.1% (95% confidence interval [CI], 70.9-75.3%). College member and resident pretest scores have been comparable (75.1% vs 71.3%, p = 0.082). Imply pretest doffing scores have been decrease than donning scores throughout all members (65.8% vs 82.8%, p<0.001). Participant scores elevated 26.9% (95% CI of the distinction 24.7-29.1%, p<0.001) following our instructional intervention leading to all members assembly the MPS of 100%.
Conclusion: A mastery studying intervention with deliberate follow ensured the right use of PPE by doctor topics in a simulated scientific encounter of a COVID-19 affected person. Additional research of translational outcomes is required.
Description: IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine activated killer cells, monocytes, macrophages and oligodendrocytes. Recombinant human IL-2 is a 15.5 kDa protein, containing 134 amino acid residues including one intrachain disulfide bond.
Description: IL-17F, a member of the IL-17 family of structurally related cytokines, has been shown to stimulate proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. Recombinant human IL-17F is a disulfide-linked homodimer of 30.1 kDa, consisting of two 133 amino acid residue chains.
Description: IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant human IL-6 is a 20.9 kDa protein containing 184 amino acid residues.
Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.
Description: IL-12 is a disulfide-linked heterodimeric protein (p70), composed of two subunits, p35 and p40, which are encoded by two different genes. Accumulating data indicate that p40 secretion precedes that of IL-12 expression. In addition, to its ability to covalently bind to p35 to form IL-12, p40 can bind to p19 to form IL-23, or can form a homodimer designated as IL-12 p80. Elevated levels of IL-12 p80 are correlated with macrophage recruitment and increased inflammation in asthma and respiratory viral infection models. Recombinant human IL-12 p80 is an 80.0 kDa disulfide linked homodimer consisting of two p40 chains of IL-12.
Description: IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 is cross-species reactive. A variant of IL-13 shows enhanced functional activity compared with the wild type IL-13. PeproTech's genetic variant, termed human IL-13 analog, is a mature 114 amino acid protein with a substitution of Q for R at position 112.
Description: IL-16 is a CD8+ T cell-derived cytokine that induces chemotaxis of CD4+ T cells and CD4+ monocytes and eosinophils. Analysis by gel filtration suggests that, under physiological conditions, hIL-16 exists predominantly as a noncovalently linked multimer, but that some IL-16 may exist as a monomer. However, only the multimeric form appears to possess chemotactic activity, suggesting that receptor cross-linking may be required for activity. IL-16 also induces expression of IL-2 receptor (IL-2R) and MHC class II molecules on CD4 + T cells. Human and murine IL-16 show significant cross-species reactivity. Recombinant human IL-16 is a 13.5 kDa protein consisting of 130 amino acid residues.
Description: IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Swine IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.
Description: IL-13 is an important mediator of allergic inflammation and disease. In addition to effects on immune cells, IL-13 is implicated as a central mediator of the physiologic changes induced by allergic inflammation in many tissues. Mouse IL-13 Recombinant Protein is purified interleukin-13 produced in yeast.
Description: Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Feline IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Feline IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.
Description: IL-17A is a member of the IL-17 family of cytokines, whose members are involved in numerous immune regulatory functions. IL-17 induces the production of many other cytokines, chemokines, and prostaglandins. Mouse IL-17A Recombinant Protein is purified interleukin-17A produced in yeast.
Description: Interleukin-8 (IL-8), also known as CXCL8, is an ELR-positive CXC family member chemokine produced by macrophages and other cell types such as epithelial cells. ELR-positive CXC chemokines such as IL-8 specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. Dolphin IL-8 Recombinant Protein is purified interleukin-8 produced in yeast.
Description: The cytokine interleukin-21 (IL-21) regulates the proliferation and differentiation of T and B lymphocytes, modulates the cytotoxic activity and survival of NK and CD8+ T cells, and suppresses the maturation of dendritic cells. Swine IL-21 Recombinant Protein is purified interleukin-21 produced in yeast.
Description: Interleukin-1 Receptor Antagonist Protein (IL-1F3, IL-1ra) belongs to the IL-1 family of cytokines, whose members play key roles in the development and regulation of inflammation. IL-1 receptor antagonist (IL-1ra; IL-1F3) reduces inflammation by blocking the binding of the agonist receptor ligands. Equine IL-1 Receptor Antagonist Recombinant Protein is purified interleukin-1 receptor antagonist protein (IL-1F3, IL-1ra) produced in yeast.
Description: IL-7 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 152 amino acids fragment (26-177) and having a total molecular mass of 21.97 kDa with an amino-terminal hexahistidine tag. ;The IL-7 His-Tag protein is purified by proprietary chromatographic techniques.
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Feline IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Feline IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
Description: 4-1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB Receptor binds to 4-1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4-1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant human soluble 4-1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine rich TNFR-like extracellular domain of 4-1BB Receptor.
Description: PF-4 is a CXC chemokine that is expressed in megakaryocytes and stored in the α-granules of platelets. PF-4 is chemotactic towards neutrophils and monocytes and has been shown to inhibit angiogenesis. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Description: Interleukin-4 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15kDa. ;The IL-4 is purified by proprietary chromatographic techniques.
Description: IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 15.1 kDa globular protein containing 130 amino acid residues.
Description: IL-4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It is a key regulator in humoral and adaptive immunity. Human IL-4 Recombinant Protein is purified interleukin-4 produced in yeast.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
Gentaur's IL-4 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4. Standards or samples are added to the micro ELISA plate wells and combined with th
Gentaur's IL-4 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4 . Standards or samples are added to the micro CLIA plate wells and combined with the
Description: IL-4 Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 14-19kDa due to glycosylation.;The IL-4 is purified by proprietary chromatographic techniques.
Description: Interleukin-4 Human Recombinant produced in CHO is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14 kDa, the glycosilation of IL-4 migrates as 18 kDa on SDS-PAGE.;The IL-4 is purified by proprietary chromatographic techniques.
Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
Medical interns’ reflections on their coaching in use of private protecting gear
Background: The present COVID-19 pandemic has demonstrated that private protecting gear (PPE) is important, to forestall the acquisition and transmission of infectious illnesses, but its use is commonly sub-optimal within the scientific setting.
Coaching and training are vital to make sure and maintain the secure and efficient use of PPE by medical interns, however present strategies are sometimes insufficient in offering the related data and expertise. The aim of this research was to discover medical graduates’ experiences of using PPE and determine alternatives for enchancment in training and coaching programmes, to enhance occupational and affected person security.
Strategies: This research was undertaken in 2018 in a big tertiary-care educating hospital in Sydney, Australia, to discover medical interns’ self-reported experiences of PPE use, at the start of their internship. Reflexive teams have been carried out instantly after theoretical and sensible PPE coaching, throughout hospital orientation. Transcripts of recorded discussions have been analysed, utilizing a thematic strategy that drew on the COM-B (functionality, alternative, motivation – behaviour) framework for behaviour.
Outcomes: 80% of 90 eligible graduates participated. Many interns had not beforehand acquired formal coaching within the particular expertise required for optimum PPE use and had developed doubtlessly unsafe habits. Their experiences as medical college students in scientific areas contrasted sharply with really useful follow taught at hospital orientation and impacted on their capability to domesticate right PPE use.
Conclusions: Undergraduate educating ought to be in keeping with greatest follow PPE use, and embody sensible coaching that embeds right and secure practices.
Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.
Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml
Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue
Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation
IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.
MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.
PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle. Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7. It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3 kDa protein containing 160 amino acid residues.
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions
(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.
Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
TGF-b-1 Transforming Growth Factor-beta 1 Human protein
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.
MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.