Skip to content
GenoCheck

GenoCheck

지노첵 – DNA chip 제품

xClose Menu
  • Home
  • Culture Cells
  • DNA
  • Enzymes
  • Clia Kits
  • Biology Cells
  • General
  • Recombinant Proteins
  • cDNA
  • Potential as a protective barrier for personal protective equipment
  • Contact Us

Medical interns’ reflections on their training in use of personal protective equipment

genocheck
October 1, 2020 Allan Craig 0 Comments

Mastery Studying Ensures Right Private Protecting Tools Use in Simulated Medical Encounters of COVID-19

Introduction: The right use of private protecting gear (PPE) limits transmission of great communicable illnesses to healthcare employees, which is critically vital within the period of coronavirus illness 2019 (COVID-19). Nevertheless, prior research illustrated that healthcare employees continuously err throughout software and elimination of PPE. The purpose of this research was to find out whether or not a simulation-based, mastery studying intervention with deliberate follow improves right use of PPE by physicians throughout a simulated scientific encounter with a COVID-19 affected person.

 

Strategies: 

  • This was a pretest-posttest research carried out within the emergency division at a big, educational tertiary care hospital between March 31-April 8, 2020. A complete of 117 topics participated, together with 56 college members and 61 resident physicians. Previous to the intervention, all members acquired institution-mandated training on PPE use by way of a web-based video and supplemental supplies.

 

  • Contributors accomplished a pretest expertise evaluation utilizing a 21-item guidelines of steps to accurately don and doff PPE. Contributors have been anticipated to fulfill a minimal passing rating (MPS) of 100%, decided by an skilled panel utilizing the Mastery Angoff and Affected person Security standard-setting strategies. Contributors that met the MPS on pretest have been exempt from the tutorial intervention.

 

  • Testing occurred earlier than and after an in-person demonstration of correct donning and doffing strategies and 20 minutes of deliberate follow. The first end result was a change in evaluation scores of right PPE use following our instructional intervention. Secondary outcomes included variations in efficiency scores between college members and resident physicians, and variations in efficiency throughout donning vs doffing sequences.

 

Outcomes: All members had a imply pretest rating of 73.1% (95% confidence interval [CI], 70.9-75.3%). College member and resident pretest scores have been comparable (75.1% vs 71.3%, p = 0.082). Imply pretest doffing scores have been decrease than donning scores throughout all members (65.8% vs 82.8%, p<0.001). Participant scores elevated 26.9% (95% CI of the distinction 24.7-29.1%, p<0.001) following our instructional intervention leading to all members assembly the MPS of 100%.

 

Conclusion: A mastery studying intervention with deliberate follow ensured the right use of PPE by doctor topics in a simulated scientific encounter of a COVID-19 affected person. Additional research of translational outcomes is required.

 

genocheck
genocheck
Anti-human IL-4 antibody
STJ15100046 St John's Laboratory 250 µg
EUR 367
Description: This monoclonal antibody enables sensitive and specific detection of human IL-4 in immunoassays such as ELISA and ELISpot.
anti- IL-4 antibody
FNab09861 FN Test 100µg
EUR 548.75
  • Recommended dilution: WB: 1:500 - 1:1000
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Gene ID: 3565
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
FNab04278 FN Test 100µg
EUR 585
  • Recommended dilution: WB: 1:500 - 1:2000
  • IHC: 1:50 - 1:100
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Gene ID: 3565
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
FNab04279 FN Test 100µg
EUR 585
  • Recommended dilution: WB: 1:500-1:5000
  • IHC: 1:20-1:200
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
LSMab09861 Lifescience Market 100 ug
EUR 386
Anti-IL-4 antibody
PAab04278 Lifescience Market 100 ug
EUR 412
Anti-IL-4 antibody
STJ93699 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4.
Anti-IL-4 antibody
STJ93700 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4.
Anti-IL-4 antibody
STJ96510 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4.
mAb mouse anti-human IL-4
CT253 U-CyTech 0.5 mg
EUR 260
Rabbit Polyclonal antibody Anti-CRBN
Anti-CRBN ImmunoStep 50 µg
EUR 349
Recombinant Human IL-2 Protein
PROTP60568-4 BosterBio 50ug
EUR 317
Description: IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine activated killer cells, monocytes, macrophages and oligodendrocytes. Recombinant human IL-2 is a 15.5 kDa protein, containing 134 amino acid residues including one intrachain disulfide bond.
Recombinant Human IL-17F Protein
PROTQ96PD4-4 BosterBio 25ug
EUR 317
Description: IL-17F, a member of the IL-17 family of structurally related cytokines, has been shown to stimulate proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. Recombinant human IL-17F is a disulfide-linked homodimer of 30.1 kDa, consisting of two 133 amino acid residue chains.
Recombinant Human IL-6 Protein
PROTP05231-4 BosterBio 20ug
EUR 317
Description: IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant human IL-6 is a 20.9 kDa protein containing 184 amino acid residues.
Recombinant Human IL-3 Protein
PROTP08700-4 BosterBio 10ug
EUR 317
Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.
Anti-mouse IL-4 antibody
STJ15100035 St John's Laboratory 250 µg
EUR 336
Description: This monoclonal antibody enables sensitive and specific detection of mouse IL-4 in immunoassays such as ELISA and ELISpot.
Anti-mouse IL-4 antibody
STJ15100036 St John's Laboratory 500 µg
EUR 527
Description: This monoclonal antibody is recommended for neutralization of mouse IL-4 bioactivity.
Anti-mouse IL-4 antibody
STJ15100037 St John's Laboratory 250 µg
EUR 367
Description: This monoclonal antibody enables sensitive and specific detection of mouse IL-4 in immunoassays such as ELISA and ELISpot.
Anti-IL-4 alpha antibody
STJ93702 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4Ralpha.
Anti-IL-4 alpha antibody
STJ93703 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4Ralpha.
Anti-IL-4 alpha antibody
STJ97665 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to IL-4Ralpha.
Recombinant Human IL-12 p80 Protein
PROTP29460-4 BosterBio 10ug
EUR 317
Description: IL-12 is a disulfide-linked heterodimeric protein (p70), composed of two subunits, p35 and p40, which are encoded by two different genes. Accumulating data indicate that p40 secretion precedes that of IL-12 expression. In addition, to its ability to covalently bind to p35 to form IL-12, p40 can bind to p19 to form IL-23, or can form a homodimer designated as IL-12 p80. Elevated levels of IL-12 p80 are correlated with macrophage recruitment and increased inflammation in asthma and respiratory viral infection models. Recombinant human IL-12 p80 is an 80.0 kDa disulfide linked homodimer consisting of two p40 chains of IL-12.
Recombinant Human IL-13 Variant Protein
PROTP35225-4 BosterBio 10ug
EUR 317
Description: IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 is cross-species reactive. A variant of IL-13 shows enhanced functional activity compared with the wild type IL-13. PeproTech's genetic variant, termed human IL-13 analog, is a mature 114 amino acid protein with a substitution of Q for R at position 112.
Human Interleukin-4 (IL-4)
1-CSB-EP011659HU Cusabio
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
  • MW: 31 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Interleukin-4(IL-4) expressed in E.coli
IL-4, Interleukin-4, human
RC212-15 BBI Biotech 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4
E13-015-1 EnoGene 10μg
EUR 161
IL-4
E13-015-2 EnoGene 50μg
EUR 505
IL-4
E21-050 EnoGene 10ug
EUR 343
IL-4
E21-D03 EnoGene 10ug
EUR 343
IL-4
E21-K15 EnoGene 10ug
EUR 343
IL-4
MO15071 Neuromics 500 ug
EUR 910
pAb rabbit anti-human IL-4 receptor
CT248 U-CyTech 0.5 mg
EUR 184
Recombinant Human IL-16 (129 a.a.) Protein
PROTQ14005-4 BosterBio 10ug
EUR 317
Description: IL-16 is a CD8+ T cell-derived cytokine that induces chemotaxis of CD4+ T cells and CD4+ monocytes and eosinophils. Analysis by gel filtration suggests that, under physiological conditions, hIL-16 exists predominantly as a noncovalently linked multimer, but that some IL-16 may exist as a monomer. However, only the multimeric form appears to possess chemotactic activity, suggesting that receptor cross-linking may be required for activity. IL-16 also induces expression of IL-2 receptor (IL-2R) and MHC class II molecules on CD4 + T cells. Human and murine IL-16 show significant cross-species reactivity. Recombinant human IL-16 is a 13.5 kDa protein consisting of 130 amino acid residues.
mAb mouse anti-rat IL-4
CT028 U-CyTech 0.5 mg
EUR 260
mAb mouse anti-rat IL-4
CT029 U-CyTech 0.5 mg
EUR 260
pAb rabbit anti-rat IL-4
CT058 U-CyTech 0.5 mg
EUR 184
mAb mouse anti-monkey IL-4
CT103 U-CyTech 0.5 mg
EUR 260
mAb rat anti-mouse IL-4
CT324 U-CyTech 0.5 mg
EUR 260
mAb rat anti-mouse IL-4
CT337 U-CyTech 0.5 mg
EUR 260
IL-4, human recombinant
4137-10 Biovision
EUR 278
IL-4, human recombinant
4137-1000 Biovision
EUR 3704
IL-4, human recombinant
4137-50 Biovision
EUR 697
Human IL-4 Protein
abx060798-20ug Abbexa 20 ug
EUR 467
  • Shipped within 5-10 working days.
rec IL-4 (human)
H-9630.0002 Bachem 2.0µg
EUR 261
rec IL-4 (human)
H-9630.0010 Bachem 10.0µg
EUR 950
Recombinant Human IL-4
P0052 FN Test 100ug
EUR 522.36
  • Formulation: pH7.4, Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose
  • Reconstitution: Sterile distilled water
  • Purity: Greater than 95% by SDS-PAGE gel analyses
  • Uniprot ID: P05112
Description: Recombinant Human protein for IL-4
Recombinant Human IL-4
SJB02-03 Amyotop 10µg/vial
EUR 285
Recombinant Human IL-4
SJB02-05 Amyotop 100µg/vial
EUR 720
Recombinant Human IL-4
SJB02-06 Amyotop 30µg/vial
EUR 430
Recombinant Human IL-8 (72 a.a.) (CXCL8) Protein
PROTP10145-4 BosterBio 25ug
EUR 317
Description: IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
Interleukin-4/IL-4
E21-K74 EnoGene 10ug
EUR 343
Swine IL-10 Recombinant Protein
R00021-4 BosterBio 5ug/vial
EUR 259
Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Swine IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.
Mouse IL-13 Recombinant Protein
R00077-4 BosterBio 5ug/vial
EUR 259
Description: IL-13 is an important mediator of allergic inflammation and disease. In addition to effects on immune cells, IL-13 is implicated as a central mediator of the physiologic changes induced by allergic inflammation in many tissues. Mouse IL-13 Recombinant Protein is purified interleukin-13 produced in yeast.
Feline IL-6 Recombinant Protein
R00102-4 BosterBio 5ug/vial
EUR 259
Description: Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Feline IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Feline IL-2 Recombinant Protein
R00387-4 BosterBio 5ug/vial
EUR 259
Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Feline IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.
Mouse IL-17A Recombinant Protein
R00421-4 BosterBio 5ug/vial
EUR 259
Description: IL-17A is a member of the IL-17 family of cytokines, whose members are involved in numerous immune regulatory functions. IL-17 induces the production of many other cytokines, chemokines, and prostaglandins. Mouse IL-17A Recombinant Protein is purified interleukin-17A produced in yeast.
Dolphin IL-8 Recombinant Protein
R00423-4 BosterBio 5ug/vial
EUR 259
Description: Interleukin-8 (IL-8), also known as CXCL8, is an ELR-positive CXC family member chemokine produced by macrophages and other cell types such as epithelial cells. ELR-positive CXC chemokines such as IL-8 specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. Dolphin IL-8 Recombinant Protein is purified interleukin-8 produced in yeast.
Swine IL-21 Recombinant Protein
R00459-4 BosterBio 5ug/vial
EUR 259
Description: The cytokine interleukin-21 (IL-21) regulates the proliferation and differentiation of T and B lymphocytes, modulates the cytotoxic activity and survival of NK and CD8+ T cells, and suppresses the maturation of dendritic cells. Swine IL-21 Recombinant Protein is purified interleukin-21 produced in yeast.
Equine IL-1ra Recombinant Protein
R00651-4 BosterBio 5ug/vial
EUR 259
Description: Interleukin-1 Receptor Antagonist Protein (IL-1F3, IL-1ra) belongs to the IL-1 family of cytokines, whose members play key roles in the development and regulation of inflammation. IL-1 receptor antagonist (IL-1ra; IL-1F3) reduces inflammation by blocking the binding of the agonist receptor ligands. Equine IL-1 Receptor Antagonist Recombinant Protein is purified interleukin-1 receptor antagonist protein (IL-1F3, IL-1ra) produced in yeast.
Human Interleukin-4 (IL-4) Antibody
32184-05111 AssayPro 150 ug
EUR 261
IL-7 Interleukin-7 Human Recombinant Protein, His Tag
PROTP13232-4 BosterBio Regular: 10ug
EUR 317
Description: IL-7 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 152 amino acids fragment (26-177) and having a total molecular mass of 21.97 kDa with an amino-terminal hexahistidine tag. ;The IL-7 His-Tag protein is purified by proprietary chromatographic techniques.
Feline IL-1 alpha Recombinant Protein
R01144-4 BosterBio 5ug/vial
EUR 259
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Feline IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.
Feline IL-1 beta Recombinant Protein
R00101-4 BosterBio 5ug/vial
EUR 259
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Feline IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
IL-4 Antibody
5137-200 Biovision
EUR 370
IL-4 Antibody
5137-30T Biovision
EUR 146
IL-4 antigen
E6IE600107 EnoGene 20ug
EUR 343
IL-4 antigen
E6L00107 EnoGene 20ug
EUR 382
rHu IL-4
AK8329-0005 Akron Biotech 5µg Ask for price
rHu IL-4
AK8329-0020 Akron Biotech 20µg Ask for price
rHu IL-4
AK8329-0100 Akron Biotech 100µg Ask for price
rHu IL-4
AK8329-1000 Akron Biotech 1mg Ask for price
IL-4 antibody
PAab09861 Lifescience Market 100 ug
EUR 386
Human FibrOut 4, for brain, neural
4-21552 CHI Scientific 1 ml Ask for price
Human FibrOut 4, for brain, neural
4-21553 CHI Scientific 5 x 1 ml Ask for price
Recombinant Human 4-1BB Receptor Protein
PROTQ07011-4 BosterBio 20ug
EUR 317
Description: 4-1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB Receptor binds to 4-1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4-1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant human soluble 4-1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine rich TNFR-like extracellular domain of 4-1BB Receptor.
Recombinant Human PF-4 (CXCL4) Protein
PROTP02776-4 BosterBio 20ug
EUR 317
Description: PF-4 is a CXC chemokine that is expressed in megakaryocytes and stored in the α-granules of platelets. PF-4 is chemotactic towards neutrophils and monocytes and has been shown to inhibit angiogenesis. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines.
Anti-IL-4 Antibody [11B11], Unconjugated-100ug
QAB81-100ug EnQuireBio 100ug
EUR 149
Anti-IL-4 Antibody [11B11], Unconjugated-500ug
QAB81-500ug EnQuireBio 500ug
EUR 233
Anti-IL-4 Antibody [11B11], APC-100ug
QAB81-APC-100ug EnQuireBio 100ug
EUR 276
Anti-IL-4 Antibody [11B11], APC-25ug
QAB81-APC-25ug EnQuireBio 25ug
EUR 131
Anti-IL-4 Antibody [11B11], PE-100ug
QAB81-PE-100ug EnQuireBio 100ug
EUR 259
Anti-IL-4 Antibody [11B11], PE-25ug
QAB81-PE-25ug EnQuireBio 25ug
EUR 141
Anti-Phospho-IL-4 alpha (Y497) antibody
STJ90720 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-IL-4Ralpha (Y497).
Interleukin 4 (IL-4) Antibody
abx234279-100ug Abbexa 100 ug
EUR 551
  • Shipped within 5-12 working days.
IL-4, Interleukin-4, monkey
RC222-15 BBI Biotech 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4, Interleukin-4, rat
RC252-15 BBI Biotech 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
Human Interleukin 4,IL-4 ELISA KIT
201-12-0093 SunredBio 96 tests
EUR 440
  • This Interleukin 4 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Interleukin 4, IL-4 ELISA KIT
CSB-E04633h-24T Cusabio 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Interleukin 4, IL-4 ELISA KIT
1-CSB-E04633h Cusabio
  • EUR 500.00
  • EUR 3402.00
  • EUR 1820.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Interleukin 4 (IL-4) CLIA Kit
abx195899-96tests Abbexa 96 tests
EUR 825
  • Shipped within 5-12 working days.
Human IL-4(Interleukin 4) ELISA Kit
EH0199 FN Test 96T
EUR 476.25
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: P05112
  • Alias: IL-4(Interleukin 4)/IL4/BCGF-1/BCGF1/BSF-1/BSF1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml
Human Interleukin 4,IL-4 ELISA KIT
CN-03206H1 ChemNorm 96T
EUR 434
Human Interleukin 4,IL-4 ELISA KIT
CN-03206H2 ChemNorm 48T
EUR 284
Human Interleukin 4(IL-4)ELISA Kit
GA-E0132HM-48T GenAsia Biotech 48T
EUR 289
Human Interleukin 4(IL-4)ELISA Kit
GA-E0132HM-96T GenAsia Biotech 96T
EUR 466
Human Interleukin-4 (IL-4) ELISA Kit
LF-EK60025 Abfrontier 1×96T
EUR 790
IL-4 Interleukin-4 Human Recombinant Protein
PROTP05112-1 BosterBio Regular: 20ug
EUR 317
Description: Interleukin-4 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15kDa. ;The IL-4 is purified by proprietary chromatographic techniques.
Human Interleukin 4(IL-4)ELISA Kit
QY-E04267 Qayee Biotechnology 96T
EUR 361
Human IL-4 ELISA kit
CT203A U-CyTech 5-plate
EUR 462
Human IL-4 ELISPOT kit
CT232-PB2 U-CyTech 2-plate
EUR 415
Human IL-4 ELISPOT kit
CT232-PB5 U-CyTech 5-plate
EUR 568
Human IL-4 ELISPOT kit
CT232-PR2 U-CyTech 2-plate
EUR 415
Human IL-4 ELISPOT kit
CT232-PR5 U-CyTech 5-plate
EUR 556
Human IL-4 ELISPOT kit
CT232-T2 U-CyTech 2-plate
EUR 360
Human IL-4 ELISPOT kit
CT232-T5 U-CyTech 5-plate
EUR 579
human IL-4, His tag
E410A04-100 EnoGene 100μg
EUR 960
IL-4 ELISA KIT|Human
EF000163 Lifescience Market 96 Tests
EUR 689
IL-4 (CHO-expressed), Human
HY-P7042 MedChemExpress 50ug
EUR 555
IL-4 (Human) ELISA Kit
K4164-100 Biovision
EUR 729
Human IL-4 ELISA kit
LF-EK50141 Abfrontier 1×96T
EUR 648
Recombinant Human IL-4 Protein
PROTP05112-5 BosterBio 15ug
EUR 317
Description: IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 15.1 kDa globular protein containing 130 amino acid residues.
Human IL-4 ELISA Kit
RK00003 Abclonal 96 Tests
EUR 521
Recombinant Human IL-4 Protein
RP00995 Abclonal 5 μg
EUR 136
Human IL-4 Recombinant Protein
R00230-5 BosterBio 5ug/vial
EUR 259
Description: IL-4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It is a key regulator in humoral and adaptive immunity. Human IL-4 Recombinant Protein is purified interleukin-4 produced in yeast.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-10ug Novoprotein 10ug
EUR 146
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-1mg Novoprotein 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-500ug Novoprotein 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-50ug Novoprotein 50ug
EUR 339
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Polyclonal Goat anti-GST α-form
GST-ANTI-1 Detroit R&D 50 uL
EUR 280
Polyclonal Goat anti-GST μ-form
GST-ANTI-2 Detroit R&D 50 uL
EUR 280
Polyclonal Goat anti-GST p-form
GST-ANTI-3 Detroit R&D 50 uL
EUR 280
Human CellExp? IL-4, Human Recombinant
6463-10 Biovision
EUR 398
Human CellExp? IL-4, Human Recombinant
6463-50 Biovision
EUR 1398
Individual Reaction Mix 4
G065-4 ABM 200 reactions
EUR 167
Human Interleukin 4 (IL-4) Detection Assay Kit
6803 Chondrex 1 kit
EUR 483.55
Description: Human Interleukin 4 (IL-4) Detection Assay Kit
Human Interleukin-4 (IL-4) Antibody (Biotin Conjugate)
32184-05121 AssayPro 150 ug
EUR 369
ELISA kit for Human IL-4 (Interleukin 4)
E-EL-H0101 Elabscience Biotech 1 plate of 96 wells
EUR 377
  • Gentaur's IL-4 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4. Standards or samples are added to the micro ELISA plate wells and combined with th
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human IL-4 (Interleukin 4) in samples from Serum, Plasma, Cell supernatant
CLIA kit for Human IL-4 (Interleukin 4)
E-CL-H0100 Elabscience Biotech 1 plate of 96 wells
EUR 584
  • Gentaur's IL-4 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4 . Standards or samples are added to the micro CLIA plate wells and combined with the
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Human IL-4 (Interleukin 4) in samples from Serum, Plasma, Cell supernatant
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-10ug Novoprotein 10ug
EUR 168
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-1mg Novoprotein 1mg
EUR 1836
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-500ug Novoprotein 500ug
EUR 1298
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-50ug Novoprotein 50ug
EUR 405
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
IL-4 Interleukin-4 Human Recombinant Protein, HEK
PROTP05112 BosterBio Regular: 10ug
EUR 317
Description: IL-4 Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 14-19kDa due to glycosylation.;The IL-4 is purified by proprietary chromatographic techniques.
IL-4 Interleukin-4 Human Recombinant Protein, CHO
PROTP05112-2 BosterBio Regular: 10ug
EUR 317
Description: Interleukin-4 Human Recombinant produced in CHO is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14 kDa, the glycosilation of IL-4 migrates as 18 kDa on SDS-PAGE.;The IL-4 is purified by proprietary chromatographic techniques.
pAb rabbit anti-rat IL-4 Biotin-labeled
CT060 U-CyTech 0.5 mg
EUR 347
Anti-IL-4 Antibody [11B11], Qfluor 630-100ug
QAB81-QF630-100ug EnQuireBio 100ug
EUR 225
Anti-IL-4 Antibody [11B11], Qfluor 630-500ug
QAB81-QF630-500ug EnQuireBio 500ug
EUR 310
Anti-IL-4 Antibody [MP4-25D2], APC-100Tests
QAB82-APC-100Tests EnQuireBio 100Tests
EUR 251
Anti-IL-4 Antibody [MP4-25D2], APC-25Tests
QAB82-APC-25Tests EnQuireBio 25Tests
EUR 141
Anti-IL-4 Antibody [MP4-25D2], PE-100Tests
QAB82-PE-100Tests EnQuireBio 100Tests
EUR 276
Anti-IL-4 Antibody [MP4-25D2], PE-25Tests
QAB82-PE-25Tests EnQuireBio 25Tests
EUR 141
Recombinant Mouse Interleukin-4/IL-4
CK15-10ug Novoprotein 10ug
EUR 146
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-1mg Novoprotein 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-500ug Novoprotein 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-50ug Novoprotein 50ug
EUR 339
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
IL-4, Interleukin-4, murine (mouse)
RC232-15 BBI Biotech 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4, murine recombinant
4138-10 Biovision
EUR 256
IL-4, murine recombinant
4138-1000 Biovision
EUR 3704
IL-4, murine recombinant
4138-50 Biovision
EUR 767
IL-4, rat recombinant
4139-10 Biovision
EUR 245
IL-4, rat recombinant
4139-1000 Biovision
EUR 3530
IL-4, rat recombinant
4139-50 Biovision
EUR 729
IL-4 Polyclonal Antibody
41560-100ul SAB 100ul
EUR 252
IL-4 Polyclonal Antibody
41560-50ul SAB 50ul
EUR 187
rHu IL-4 (cGMP)
AK9839-0000 Akron Biotech 1mg Ask for price
rHu IL-4 (cGMP)
AK9839-0100 Akron Biotech 100ug Ask for price
IL-4 Polyclonal Antibody
ABP52876-003ml Abbkine 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP52876-01ml Abbkine 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP52876-02ml Abbkine 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP54878-003ml Abbkine 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4

 

Medical interns’ reflections on their coaching in use of private protecting gear

 

Background: The present COVID-19 pandemic has demonstrated that private protecting gear (PPE) is important, to forestall the acquisition and transmission of infectious illnesses, but its use is commonly sub-optimal within the scientific setting.

 

Coaching and training are vital to make sure and maintain the secure and efficient use of PPE by medical interns, however present strategies are sometimes insufficient in offering the related data and expertise. The aim of this research was to discover medical graduates’ experiences of using PPE and determine alternatives for enchancment in training and coaching programmes, to enhance occupational and affected person security.

 

Strategies: This research was undertaken in 2018 in a big tertiary-care educating hospital in Sydney, Australia, to discover medical interns’ self-reported experiences of PPE use, at the start of their internship. Reflexive teams have been carried out instantly after theoretical and sensible PPE coaching, throughout hospital orientation. Transcripts of recorded discussions have been analysed, utilizing a thematic strategy that drew on the COM-B (functionality, alternative, motivation – behaviour) framework for behaviour.

 

Outcomes: 80% of 90 eligible graduates participated. Many interns had not beforehand acquired formal coaching within the particular expertise required for optimum PPE use and had developed doubtlessly unsafe habits. Their experiences as medical college students in scientific areas contrasted sharply with really useful follow taught at hospital orientation and impacted on their capability to domesticate right PPE use.

 

Conclusions: Undergraduate educating ought to be in keeping with greatest follow PPE use, and embody sensible coaching that embeds right and secure practices.

 

Dkk-1 Polyclonal Antibody

41928-100ul SAB 100ul
EUR 252

Dkk-1 Polyclonal Antibody

41928-50ul SAB 50ul
EUR 187

Dkk-1 Polyclonal Antibody

ABP53293-003ml Abbkine 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-01ml Abbkine 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-02ml Abbkine 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ES4292-100ul ELK Biotech 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody

ES4292-50ul ELK Biotech 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Anti-Dkk-1 antibody

STJ97257 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody

STJ98000 St John's Laboratory 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-1.

Human CellExp? DKK-1, Human Recombinant

7132-10 Biovision
EUR 278

Human CellExp? DKK-1, Human Recombinant

7132-50 Biovision
EUR 1132

Dkk-2

GT15222 Neuromics 100 ug
EUR 526

ELISA kit for Human DKK-1

EK5390 SAB 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1 PicoKine ELISA Kit

EK0867 BosterBio 96 wells
EUR 425
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Dkk-1 Polyclonal Conjugated Antibody

C41928 SAB 100ul
EUR 397

DKK-1 (CHO-expressed), Mouse

HY-P7154 MedChemExpress 50ug
EUR 762

Recombinant Mouse Dkk-1 Protein

RP01062 Abclonal 5 μg
EUR 183

Dkk-3 antibody

22898-100ul SAB 100ul
EUR 390

Human DKK-1 ELISA kit (4×96T)

LF-EK50798 Abfrontier 4×96T
EUR 2201

DKK-3 ELISA KIT|Human

EF000091 Lifescience Market 96 Tests
EUR 689

Recombinant Human Dkk-3 Protein

RP00355 Abclonal 10 μg
EUR 164

ELISA kit for Rat DKK-1

EK5668 SAB 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit

EH0113 FN Test 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: O94907
  • Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-3 Polyclonal Antibody

ABP54542-003ml Abbkine 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-01ml Abbkine 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-02ml Abbkine 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ES5541-100ul ELK Biotech 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ES5541-50ul ELK Biotech 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Anti-Dkk-3 antibody

STJ92720 St John's Laboratory 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-3.

Anti-Dkk-3 antibody

STJ98001 St John's Laboratory 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-3.

Human DKK-4 PicoKine ELISA Kit

EK0868 BosterBio 96 wells
EUR 455
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Human DKK-3 PicoKine ELISA Kit

EK1323 BosterBio 96 wells
EUR 425
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein

RP00209 Abclonal 10 μg
EUR 155

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-100g Creative Biolabs 100 µg
EUR 848
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-1mg Creative Biolabs 1 mg
EUR 4724
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-100g Creative Biolabs 100 µg
EUR 1013
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-1mg Creative Biolabs 1 mg
EUR 4999
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-1mg Creative Biolabs 1 mg
EUR 6374
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-250g Creative Biolabs 250 µg
EUR 2470
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-25g Creative Biolabs 25 µg
EUR 765
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-500g Creative Biolabs 500 µg
EUR 4449
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-50g Creative Biolabs 50 µg
EUR 1013
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-200g Creative Biolabs 200 µg
EUR 3844
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-25g Creative Biolabs 25 µg
EUR 1013
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit

EH0114 FN Test 96T
EUR 567.6
  • Detection range: 62.5-4000 pg/ml
  • Uniprot ID: Q9UBP4
  • Alias: DKK-3/Dickkopf-3/Dkk3/REIC
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-1mg Creative Biolabs 1 mg
EUR 5494
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-50g Creative Biolabs 50 µg
EUR 848
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-200g Creative Biolabs 200 µg
EUR 1123
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-20g Creative Biolabs 20 µg
EUR 380
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Hemokinin 1 (human)

B5318-1 ApexBio 1 mg
EUR 340

Endothelin-1 (1-15), amide, human

A1111-1 ApexBio 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

7536-1 Biovision
EUR 321

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-10ug Novoprotein 10ug
EUR 156
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-1mg Novoprotein 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-500ug Novoprotein 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-50ug Novoprotein 50ug
EUR 369
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

BNP (1-32), human

A1105-1 ApexBio 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant

P1016-.1 ApexBio 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 ApexBio 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 BosterBio Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 BosterBio Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 BosterBio Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Parathyroid hormone (1-34) (human)

A1129-1 ApexBio 1 mg
EUR 166
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 ApexBio 100 ug
EUR 276

ApoA-1, human recombinant protein

P1052-.1 ApexBio 100 µg
EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 ApexBio 1 mg
EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 ApexBio 1 mg
EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human ANG-1 Protein

PROTQ15389-1 BosterBio 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 BosterBio 50ug
EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 BosterBio Regular: 10ug
EUR 317
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human Galectin-1 Protein

PROTP09382-1 BosterBio 50ug
EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein

PROTP16284-1 BosterBio 50ug
EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 BosterBio Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9

PROTP58417-1 BosterBio Regular: 10ug
EUR 317
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 AssayPro 96 Well Plate
EUR 477

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 AssayPro 96 Well Plate
EUR 477

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 AssayPro 96 Well Plate
EUR 477

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 AssayPro 96 Well Plate
EUR 417

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 BosterBio Regular: 20ug
EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 BosterBio Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 BosterBio Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Ac-Endothelin-1 (16-21), human

A1016-1 ApexBio 1 mg
EUR 84
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 ApexBio 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 ApexBio 1 mg
EUR 518

Human Hexokinase-1 AssayMax ELISA Kit

EH3101-1 AssayPro 96 Well Plate
EUR 477

Human Complexin-1 AssayMax ELISA Kit

EC3505-1 AssayPro 96 Well Plate
EUR 417

Human Glutaredoxin-1 AssayMax ELISA Kit

EG2153-1 AssayPro 96 Well Plate
EUR 417

OryzaExp? IGF-1 LR3, Human Recombinant

P1399-1 Biovision
EUR 881

IFN-alpha 1, human recombinant protein

P1058-.1 ApexBio 100 µg
EUR 313
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

IFN-alpha 1, human recombinant protein

P1058-1 ApexBio 1 mg
EUR 2277
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

Post navigation

Previous PostPrevious
Next PostNext

Recent Posts

  • High-Level Disinfection of Reusable Neonatal Resuscitation Equipment
  • A Complete-Cell Yeast Biosensor with an Olfactory Reporter for Low-Value and Gear-Free
  • Medical interns’ reflections on their training in use of personal protective equipment
  • First report on the feasibility of a permanently implantable uni-directional planar
  • Implementation of a Teleconsultation Protocol in a Hospital Emergency Department

Categories

  • Biology Cells
  • cDNA
  • Clia Kits
  • Culture Cells
  • DNA
  • Enzymes
  • General
  • Recombinant Proteins
January 2021
M T W T F S S
 123
45678910
11121314151617
18192021222324
25262728293031
« Oct    

Tags

celia kitzinger celia kitzinger york cia kids cia kids camp cia kids classes cia kids code cia kids cooking cia kids games cia kids gov cia kids page cia kids program cia kids zone cla kids clakids.org clia kit clia waived pregnancy kits clia waived rsv kits clima kids turma da monica clima kissimmee clima kissimmee florida clio kids throwing rocks enzymes and substrates enzymes are a type of enzymes are considered enzymes are proteins enzymes are what type of biological molecule enzymes definition enzymes definition biology enzymes examples enzymes for digestion enzymes for wine enzymes function enzymes graph enzymes in biology enzymes in biotechnology enzymes in body enzymes in brain enzymes in honey enzymes in liver enzymes in spanish enzymes in the blood after a heart attack enzymes roles enzymes speed up biochemical reactions by enzymes structure enzymes work by

Pages

  • Contact Us
  • Potential as a protective barrier for personal protective equipment
    • Research reagents
January 2021
M T W T F S S
 123
45678910
11121314151617
18192021222324
25262728293031
« Oct    

Categories

  • Biology Cells
  • cDNA
  • Clia Kits
  • Culture Cells
  • DNA
  • Enzymes
  • General
  • Recombinant Proteins

Quick Links

  • Contact Us
  • Potential as a protective barrier for personal protective equipment
    • Research reagents

Recent Posts

  • High-Level Disinfection of Reusable Neonatal Resuscitation Equipment
  • A Complete-Cell Yeast Biosensor with an Olfactory Reporter for Low-Value and Gear-Free
  • Medical interns’ reflections on their training in use of personal protective equipment
  • First report on the feasibility of a permanently implantable uni-directional planar
  • Implementation of a Teleconsultation Protocol in a Hospital Emergency Department
Business WordPress Theme